DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and ECHDC2

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011540011.1 Gene:ECHDC2 / 55268 HGNCID:23408 Length:318 Species:Homo sapiens


Alignment Length:215 Identity:50/215 - (23%)
Similarity:89/215 - (41%) Gaps:32/215 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QGYKELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVF-TGVGDIFTSG 67
            ||..|:|:           |.|..:|.:..|...|:...|.::.:|..|.:::| :||..:|.:|
Human    40 QGITEILM-----------NRPSARNALGNVFVSELLETLAQLREDRQVRVLLFRSGVKGVFCAG 93

  Fly    68 NDLSQSSNTD--DIDAFFKQSN------ATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCD 124
            .||.:.....  ::..|.::..      |.|.|.          .:|.::|.|:|.|..:...||
Human    94 ADLKEREQMSEAEVGVFVQRLRGLMNDIAAFPAP----------TIAAMDGFALGGGLELALACD 148

  Fly   125 VAWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKA 189
            :...:.:.......|..||:|..|.:..||..||.:.|.|::.....||..||:....|:.....
Human   149 LRVAASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLSGTEAHVLGLVNHAVAQ 213

  Fly   190 SELESVIWPKLRQYSE--LP 207
            :|.....:.:.|..::  ||
Human   214 NEEGDAAYQRARALAQEILP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 44/196 (22%)
ECHDC2XP_011540011.1 crotonase-like 38..252 CDD:304874 50/215 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.