DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Echdc1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006512860.1 Gene:Echdc1 / 52665 MGIID:1277169 Length:374 Species:Mus musculus


Alignment Length:241 Identity:62/241 - (25%)
Similarity:112/241 - (46%) Gaps:19/241 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GYKELLVEQQGKLLVAKFNNPKKKNCINRV-AYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGN 68
            |..:||.:|.| :.:...|||.|.|..:.| ..|.:.||:...|..||..:::. |..:.|.||:
Mouse   120 GSIDLLKKQNG-IGILTLNNPNKMNAFSGVMMLQLLERVIELENWTEGKGLIIH-GAKNTFCSGS 182

  Fly    69 DLS--QSSNTDDID---AFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWC 128
            ||:  ::.:|.:..   :.|.|:..|      .|:....|.:|||.|.|:|.||.:...||....
Mouse   183 DLNAVKALSTPESGVALSMFMQNTLT------RFMRLPLISVALVQGWAMGGGAELTTACDFRLM 241

  Fly   129 SETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELE 193
            :|.:.......::|:||..|.:..|..|:|..:|.::|..:..|.::||........:.:.|: |
Mouse   242 TEESVIRFVHKEMGIVPSWGGTSRLVEIIGSRQALKVLSGTLKLDSKEALNIGLTDEVLQPSD-E 305

  Fly   194 SVIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQ 239
            :....:.:::.|    ..:.|...|..|..:::..|.|...::.||
Mouse   306 TTALEQAQEWLE----KFVSGPPQVIRGLKKSVCSARELYIEEALQ 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 53/193 (27%)
Echdc1XP_006512860.1 crotonase-like 124..318 CDD:119339 54/206 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.