DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and echdc1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031757537.1 Gene:echdc1 / 496886 XenbaseID:XB-GENE-958554 Length:330 Species:Xenopus tropicalis


Alignment Length:256 Identity:55/256 - (21%)
Similarity:103/256 - (40%) Gaps:38/256 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GYKELLVEQQ------GKLLVAK---------FNNPKKKNCINRVAYQEMTRVLTEV-NDDEGVT 53
            |:.|..::::      |.:.::|         .|||.:.|........|:...:::: |...|..
 Frog    62 GFNEAKIKEKLAQFTGGSVDLSKMDNGIAEICINNPSRMNAFTGTMMIELEERISDLENWKNGKG 126

  Fly    54 IVVFTGVGDIFTSGNDLSQSSNTDDIDAFFKQSNATFKAMVLSFVNCR-----KIVLALVNGPAI 113
            ::|: |..:.|.||:||:.      :.|...........|::.....|     .|.:||:.|.|:
 Frog   127 LIVY-GAENTFCSGSDLNA------VKAISNPQEGMMMCMLMQNTLTRLQRLPLISVALIQGKAL 184

  Fly   114 GIGATIVGLCDVAWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAY 178
            |.||.:...||....:|.:.......::||||..|.:..|..::|...|.::|..:..:..:.|.
 Frog   185 GGGAELCTACDFRLMTEGSEIRFVHKQMGLVPGWGGAARLIHLIGSRHALKLLSGALRVHPENAL 249

  Fly   179 QFNFVSRIFKA------SELESVIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAE 233
            :......|...      ||.|:.|.|    |.:.|::.....|:::..|..:.|..|...|
 Frog   250 ELGLADNILLGTEDGFLSEAENWIMP----YIKGPSDVSRAVKKVIISGREQKLEDALRTE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 44/214 (21%)
echdc1XP_031757537.1 crotonase-like 86..273 CDD:119339 42/193 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.