DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and zgc:101569

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001005995.2 Gene:zgc:101569 / 449822 ZFINID:ZDB-GENE-041010-72 Length:309 Species:Danio rerio


Alignment Length:198 Identity:50/198 - (25%)
Similarity:96/198 - (48%) Gaps:9/198 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGNDLSQSSNT 76
            |::|.:::...|.|:.:|.:||...|.:|..|:..:.|:.:.:.|..|||..|.:|.||.:.::.
Zfish    52 ERRGAVMLIGINRPEARNAVNRETAQRLTEELSAFDQDDSLNVTVLYGVGGNFCAGFDLKELAHG 116

  Fly    77 DDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETTYFYTPFTKL 141
            .|.....:..::....|..|.:...|.::|.|:|.|:..|..:..|.|:....|::.......:.
Zfish   117 SDSLELEQDVSSGPGPMGPSRMRLSKPLIAAVSGYAVAGGLELALLADMRVAEESSIMGVFCRRF 181

  Fly   142 GLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIF-------KASELESVI--W 197
            |:....|.:..||.::|.|:|.:::|...|:.|.||..|...:|:.       :|.||...:  :
Zfish   182 GVPLIDGGTVRLPQLIGLSRALDLILTGRPVKAHEALAFGLANRVVPDGQALQEALELAEQVSAF 246

  Fly   198 PKL 200
            |:|
Zfish   247 PQL 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 48/193 (25%)
zgc:101569NP_001005995.2 PRK08259 46..304 CDD:236205 50/198 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582200
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.