DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and echs1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001005437.1 Gene:echs1 / 448019 XenbaseID:XB-GENE-5945792 Length:286 Species:Xenopus tropicalis


Alignment Length:252 Identity:71/252 - (28%)
Similarity:118/252 - (46%) Gaps:26/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKELLVEQQGK---LLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSG 67
            ::.:|||::|:   :.:.:.|.||..|.:......|:.:.|....:|..:..:|.||....|.:|
 Frog    29 FQYILVERKGQHHNVGLIRLNRPKALNALCDGLMTEINQALDTFEEDPNIGAIVITGSERAFAAG 93

  Fly    68 NDLSQSSNTDDIDA----FFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWC 128
            .|:.:..|....:.    |....|.      :|||  :|.|:|.|||.|:|.|..:..:||:.:.
 Frog    94 ADIKEMQNRSFQECYGGNFLSHWNR------VSFV--KKPVIAAVNGYALGGGCELAMMCDIIYA 150

  Fly   129 SETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELE 193
            .|...|..|...||.:|..|.:..|...:|:|.|.|::|..:.:|||||.|...||:::   .::
 Frog   151 GEKAEFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLSGDRISAQEAQQAGLVSKVY---PVD 212

  Fly   194 SVIWPKLRQYSELPTNSLL---QGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFA 247
            ||:...:....::..||.|   ..|..|...|..:|.:.|..| |:|.    |..||
 Frog   213 SVVDQAIICGEKIARNSKLIVSIAKEAVSAAFELSLAEGNRLE-KRLF----HSTFA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 57/194 (29%)
echs1NP_001005437.1 crotonase-like 28..286 CDD:329030 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.