DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and auh

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001003576.2 Gene:auh / 445182 ZFINID:ZDB-GENE-040801-95 Length:325 Species:Danio rerio


Alignment Length:171 Identity:40/171 - (23%)
Similarity:79/171 - (46%) Gaps:7/171 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGV-TIVVFTGVGDIFTSGNDLSQSS--NTDD 78
            ::|...|.|:.||.|::.....|:..|..:..|..| |:::.:.|..||.:|.||.:.:  ...:
Zfish    75 IVVMGINRPEAKNAISKNLVSMMSEALESMKTDNTVRTVILCSMVPGIFCAGADLKERAKMQQSE 139

  Fly    79 IDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETTYFYTPFTKLGL 143
            :..|..::    :.::..........:|.::|.|:|.|..:...||:...:.:.......|||.:
Zfish   140 VGPFVTKA----RTLISELGALPMPTIAAIDGAALGGGLEMALACDIRVAANSAKMGLVETKLAI 200

  Fly   144 VPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVS 184
            :|..|.:..||..:|.|.|.|::..:..|:.:||.....|:
Zfish   201 IPGAGGTQRLPRTVGVSIAKELIFAARVLNGEEAKSLGLVN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 40/171 (23%)
auhNP_001003576.2 crotonase-like 71..325 CDD:304874 40/171 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.