DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and HIPP1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649261.1 Gene:HIPP1 / 40302 FlyBaseID:FBgn0037027 Length:926 Species:Drosophila melanogaster


Alignment Length:249 Identity:55/249 - (22%)
Similarity:89/249 - (35%) Gaps:51/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KFNNPKKKNC---INRVAY-------------------QEMTRVLTEVNDDEGVTIVVFTGVGDI 63
            |.||..:..|   :|:||:                   :::...|:.|........|:.|..|..
  Fly   663 KANNGSELVCLHKVNKVAHLVIHTERGNFGHTYSKQLLEQLNDTLSSVARKGEFNTVLLTVEGPQ 727

  Fly    64 FTSGND---LSQSSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDV 125
            |..|.|   |.|.|.....|: ..|.....|..:.:.....|.::|.:.|..|.:|...:...|.
  Fly   728 FCQGIDCQELIQGSLEKRKDS-ASQLAVALKCYLRTLATFPKPLVAGIVGSQINLGVMQLPFADY 791

  Fly   126 AWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFN-FVSRIFKA 189
            ...|:...|.|.:.|||.:|||.:.:.....:.....|.:.|:.|.|.|.|..:.| ||.:|.||
  Fly   792 VVASDDCSFETNYAKLGQLPEGYALWHGHQRVSSEVHSRLFLMGERLFATELLESNSFVDKICKA 856

  Fly   190 SELESVIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQH 243
            ..:..:...|.:|                        |..:.||..:.|::..|
  Fly   857 RNVNEMALAKAKQ------------------------ISTSSAEMYRTLKKLNH 886

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 48/201 (24%)
HIPP1NP_649261.1 crotonase-like 673..870 CDD:119339 46/221 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468438
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.