DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and CG6984

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_611187.1 Gene:CG6984 / 36926 FlyBaseID:FBgn0034191 Length:285 Species:Drosophila melanogaster


Alignment Length:271 Identity:64/271 - (23%)
Similarity:120/271 - (44%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TYQGYKEL-LVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFT 65
            |..|..:| ||::...:.....|:||..|.::......:...|.:..|:..:..||.|..|.|::
  Fly    26 TSNGPSDLVLVKEHNGVREITLNHPKTLNSLSLDMMCALQDALLKDKDNLDLRCVVLTAQGKIWS 90

  Fly    66 SGNDLSQSSNTDDIDAFFKQSNATFKAMVLSFVNCRKI---VLALVNGPAIGIGATIVGLCDVAW 127
            :|::|.:..|...|.|      ..|:.:.....:.:::   ||..|||.|...|..:|..||:..
  Fly    91 AGHNLKELHNDPKIQA------CVFQKLTDVINDIQRLPVPVLGKVNGYAAAAGCQLVVSCDMVV 149

  Fly   128 CSETTYFYTPFTKLGL---VPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKA 189
            |::.:.|.||...:|:   .|    ...:..|:.|.|::.:|:...|::.:|||....|::...|
  Fly   150 CTKNSKFSTPGAGVGVFCSTP----GVAVARIMSRPKSAYMLMTGLPVTGEEAYISGMVTKAVPA 210

  Fly   190 SELESVIWPKLRQYSELPTNSLLQGKRLV----KDGFLENL----IKANEAECKQLLQQFQHPEF 246
            .||:..|        |..||::....|.|    |:.:.:.|    .:|..|..:::.:.||..:.
  Fly   211 EELDKEI--------EEITNAIKAKSRAVISLGKEFYYKQLAMSQAEAFSAAQEKMCENFQLGDT 267

  Fly   247 AQAIIDFASRK 257
            .:.|..|..::
  Fly   268 KEGIASFFEKR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 48/194 (25%)
CG6984NP_611187.1 crotonase-like 24..283 CDD:304874 64/271 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451167
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.