DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Echs1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610910.1 Gene:Echs1 / 36536 FlyBaseID:FBgn0033879 Length:295 Species:Drosophila melanogaster


Alignment Length:263 Identity:64/263 - (24%)
Similarity:118/263 - (44%) Gaps:25/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKELLVEQQGKLL-VAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGND 69
            |.:..|..:||.: |...|.||..|.:.....:|::..|.:.:.|:.::.:|.||....|.:|.|
  Fly    40 YIKTEVAGEGKNVGVITLNRPKALNALCNGLMKELSTALQQFSKDKTISAIVLTGSEKAFAAGAD 104

  Fly    70 LSQSSNTDDIDAFFKQSNATFKAMVLSFVN-------CRKIVLALVNGPAIGIGATIVGLCDVAW 127
            :.:           ...|...:.:..:|:|       .:|.::|.|||.|:|.|..:..:||:.:
  Fly   105 IKE-----------MVGNTYSQCIQGNFLNDWTEVARTQKPIIAAVNGYALGGGCELAMMCDIIY 158

  Fly   128 CSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASEL 192
            ..:...|..|...||.:|..|.:..|..::|:|||.|:.|....:.||||.:....|::..|.:|
  Fly   159 AGDKAKFGQPEIALGTIPGAGGTQRLTRVVGKSKAMEMCLTGNMIGAQEAEKLGLASKVVPADQL 223

  Fly   193 --ESVIWPKLRQYSELPTNSLLQ-GKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFA 254
              |:|   ||.:.....:|.::| .|..|...:...|.:..:.|.:.....|...:..:.:..||
  Fly   224 LGEAV---KLGEKIGTHSNLIVQLCKEAVNTAYETTLQEGLKFERRTFHATFSTADRKEGMTAFA 285

  Fly   255 SRK 257
            .::
  Fly   286 EKR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 52/197 (26%)
Echs1NP_610910.1 crotonase-like 37..294 CDD:304874 64/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451164
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.