DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and CG8778

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster


Alignment Length:222 Identity:56/222 - (25%)
Similarity:100/222 - (45%) Gaps:17/222 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELLVE-----QQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVG-DIFTS 66
            |:|||     :|| :.|...|.|..||..:|...:....||.::..|.|..:||...:. .||.:
  Fly    36 EVLVERLDGARQG-ISVIGLNRPAAKNSFSRGMVETFNDVLEDIKKDNGSRVVVLRSLSPGIFCA 99

  Fly    67 GNDLSQ--SSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCS 129
            |.||.:  ....::...|.|:    .:.::::.......|:|.|:|.|:|.|..:...||:...:
  Fly   100 GADLKERKGMTPEEATEFVKE----LRGLLIAIEQLPMPVIAAVDGAALGGGLEMALACDIRTAA 160

  Fly   130 ETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELES 194
            ..|......|:|.::|..|.:..||.||..:.|.|::..:...:..||.....|:.:.|.:|.:.
  Fly   161 SDTKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIFTARVFNGAEAKDLGLVNHVVKQNETQD 225

  Fly   195 VIWPKLRQYSE--LPTNSLLQGKRLVK 219
            ..:.:..:.:|  ||...:  |.|:.|
  Fly   226 AAYQQALKLAEEILPNGPV--GVRMAK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 49/195 (25%)
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 51/210 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451170
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.