DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Echdc1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001007735.1 Gene:Echdc1 / 361465 RGDID:1359654 Length:299 Species:Rattus norvegicus


Alignment Length:243 Identity:60/243 - (24%)
Similarity:107/243 - (44%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVEQQGKLLVAKFNNPKKKNCIN-RVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGNDLSQS 73
            |.::|..:.:...||..|.|..: .:..|.:.||:...|..||..::|. |..:.|.||:||:. 
  Rat    49 LQKKQNGIGILTLNNSNKMNAFSGAMMLQLLERVIELENWTEGKGLIVH-GAKNTFCSGSDLNA- 111

  Fly    74 SNTDDIDAFFKQSNATFKAMVLS-----FVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETTY 133
                 :.|.....|....:|.:.     |:....|.:|||.|.|:|.||.:...||....:|.:.
  Rat   112 -----VKALSTPENGVALSMFMQNTLTRFMRLPLISVALVQGWAMGGGAELTTACDFRLMTEESV 171

  Fly   134 FYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVI-- 196
            ......::|:||..|.:..|..|:|..:|.::|..:..|.::||.:......:.:.|:..:.:  
  Rat   172 IRFVHKEMGIVPSWGGASRLVEIIGSRQALKVLSGTFKLDSKEALRIGLADEVLQPSDEATALEQ 236

  Fly   197 ---WPKLRQYSELPTNSLLQGKRLVKDG---FLENLIKANEAECKQLL 238
               |  |.|:...|...:...|:.|..|   :||..:: ||.:..:.|
  Rat   237 AQEW--LEQFVSGPAQVIRGLKKSVCSGRELYLEEALQ-NERDVLETL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 48/197 (24%)
Echdc1NP_001007735.1 crotonase-like 52..243 CDD:119339 49/199 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.