DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Cdyl

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017456089.1 Gene:Cdyl / 361237 RGDID:1549745 Length:617 Species:Rattus norvegicus


Alignment Length:255 Identity:74/255 - (29%)
Similarity:128/255 - (50%) Gaps:4/255 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKELLV-EQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGND 69
            |::::| :|.|...:.......:.|.:|....:|:...|:....|:. .:|:.:.||.:|..|.|
  Rat   360 YRDIVVRKQDGFTHILLSTKSSENNSLNPEVMKEVQSALSTAAADDS-KLVLLSAVGSVFCCGLD 423

  Fly    70 LSQSSN--TDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETT 132
            ......  |||......:.....:..|.:|:..:|.::..|||||||:||:|:.||||.|.:|..
  Rat   424 FIYFIRRLTDDRKRESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCDVVWANEKA 488

  Fly   133 YFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIW 197
            :|.||:|..|..|:|.|:.|.|.|:|.:.|:|:||....|:||||.....||::|........:.
  Rat   489 WFQTPYTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQVFWPGTFTQEVM 553

  Fly   198 PKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFASRK 257
            .::::.:......|.:.|.||:......|.:|||.||..|.:.:...:...:::.:..||
  Rat   554 VRIKELASCNPIVLEESKALVRCNMKMELEQANERECDALKKIWGSAQGMDSMLKYLQRK 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 60/190 (32%)
CdylXP_017456089.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46426
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.