DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Auh

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006253736.1 Gene:Auh / 361215 RGDID:1306087 Length:315 Species:Rattus norvegicus


Alignment Length:253 Identity:56/253 - (22%)
Similarity:111/253 - (43%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGV-TIVVFTGVGDIFTSGNDLSQS 73
            |.|:...::|...|....||.:::...:.:::.:..:..|:.| ||::.:.|..||.:|.||.:.
  Rat    58 LEEENRGIVVLGINRAYGKNSLSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKER 122

  Fly    74 S--NTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETTYFYT 136
            :  ::.::..|..:    .:|::....|.....:|.::|.|:|.|..:...||:...:.:.....
  Rat   123 AKMHSSEVGPFVSK----IRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGL 183

  Fly   137 PFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIWPKLR 201
            ..|||.::|.||.:..||..:|.:.|.|::..:..|..|||.....:|.:.:.::.....:   |
  Rat   184 VETKLAIIPGGGGTQRLPRAIGMALAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAAY---R 245

  Fly   202 QYSELPTNSLLQG-------KRLVKDGFLENLIK--ANEAECKQLLQQFQHPEFAQAI 250
            :..:|....|.||       |..:..|...:|:.  |.|..|           :||.|
  Rat   246 KALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEAC-----------YAQTI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 42/189 (22%)
AuhXP_006253736.1 crotonase-like 62..315 CDD:329030 54/249 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.