DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and CG4594

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001260305.1 Gene:CG4594 / 34316 FlyBaseID:FBgn0032161 Length:280 Species:Drosophila melanogaster


Alignment Length:211 Identity:35/211 - (16%)
Similarity:76/211 - (36%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GYKELLVEQQGKLLVAKFN----------NPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTG 59
            |....|:....||...:.|          |....|..|.....::...::|:.:::...:::.:.
  Fly    13 GAPSRLMSTATKLTTVEINDKTGIATLTMNRPPVNSQNVQLLLDLQTSISEIENNKSRGLILTSA 77

  Fly    60 VGDIFTSGNDLSQSSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLAL----------VNGPAIG 114
            ..::|::|.|:.:..|||            .:.:...:...:.:.:||          :||.|..
  Fly    78 SSNVFSAGLDIFEMYNTD------------VERLRTVWTELQNVWIALYGTTLPTAAAINGHAPA 130

  Fly   115 IGATIVGLCDVAWCSETTYFYTPFTKLGLV-PE---GGSSYMLPLILGRSKASEILLLSEPLSAQ 175
            .|..:...|:...............:||:: |:   .|.:.:||    :..|...|......:.|
  Fly   131 GGCLLATACEYRVMRPNFLIGLNEAQLGIIAPKWLMSGFASILP----KRVAERALTQGRMFTTQ 191

  Fly   176 EAYQFNFVSRIFKASE 191
            ||::...:..|..:.|
  Fly   192 EAFEVGLIDEIASSKE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 34/207 (16%)
CG4594NP_001260305.1 crotonase-like 35..275 CDD:304874 30/189 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451134
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.