DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and CG4598

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001260304.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster


Alignment Length:238 Identity:47/238 - (19%)
Similarity:87/238 - (36%) Gaps:75/238 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VEQQGKLLVAKFN-NPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGNDLSQ-- 72
            ||...|..:|... |....|.:|....|::...:.|:..::...:::.:....||::|.|:.:  
  Fly    28 VEVNDKTGIATLTMNRPPVNGLNLELLQDLKSSIDEIESNKSRGLILTSSSSTIFSAGLDILEMY 92

  Fly    73 SSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNG--PA-------------------IGIG 116
            ..:.|.|.||:.|...|:.|:..|.|.    ..|.:||  ||                   ||:.
  Fly    93 KPDKDRIRAFWTQLQDTWLALYGSSVP----TAAAINGHSPAGGCLLATSCEYRVMVPNFTIGLN 153

  Fly   117 ATIVGLCDVAWCSETTYFYTP-------------FT-----KLGLVPEGGSSYMLPLILGRSKAS 163
            .|.:|:....|...:.....|             ||     |:||:.|..::        :.:|.
  Fly   154 ETQLGIVAPQWFMASFLSVLPQRIAERALNQGRMFTTEEALKVGLIDETANN--------KEEAI 210

  Fly   164 E-----------ILLLSEPLSAQEAYQFNFVSRIFKASELESV 195
            |           :..|:..|:.|:          |:|::|:.:
  Fly   211 EKCVAFIGTFAKVNPLARSLTKQQ----------FRAADLQQL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 47/238 (20%)
CG4598NP_001260304.1 crotonase-like 27..217 CDD:119339 41/200 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451137
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.