DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and echdc2

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_997953.1 Gene:echdc2 / 338247 ZFINID:ZDB-GENE-030219-147 Length:301 Species:Danio rerio


Alignment Length:176 Identity:42/176 - (23%)
Similarity:75/176 - (42%) Gaps:33/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 KKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTG-VGDIFTSGNDLSQSSNTDDIDAFFKQSNAT 89
            :.:|.:..|...:|..:::.:..|..|.::||.. :..:|.:|.||.:.:         :.|||.
Zfish    60 RARNSLGHVFVGQMRDLVSSLQHDSAVRVLVFRSLIPGVFCAGADLKERA---------QMSNAE 115

  Fly    90 FKAMVLSFVNCRKIVLAL-------VNGPAIGIGATIVGLCDV---AWCS-----ETTYFYTPFT 139
            .:..|....:....:.||       |:|.|:|.|..:...||:   |.|:     |||       
Zfish   116 AELFVHGLRSLMNDIAALPMPTIAAVDGFALGGGLELALACDLRTAAHCAQMGLIETT------- 173

  Fly   140 KLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSR 185
             .||:|..|.|..||..:|.:.|.|::.....:..::|.....|:|
Zfish   174 -RGLLPGAGGSQRLPRTVGFAVAKELIFTGRRVGGEQAVNLGLVNR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 42/176 (24%)
echdc2NP_997953.1 crotonase-like 47..301 CDD:304874 42/176 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.