DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and CG9577

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608375.1 Gene:CG9577 / 33016 FlyBaseID:FBgn0031092 Length:312 Species:Drosophila melanogaster


Alignment Length:264 Identity:60/264 - (22%)
Similarity:112/264 - (42%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGNDLSQSSN-------TDD 78
            :.:.|.|.|.|::..:.|:......:..:.....:|.:..|..||:|.||:...|       |||
  Fly    56 ELHRPSKFNAISKQMWLEIKECFDGLATNPDCRAIVLSASGKHFTAGIDLNDMINVGQTLAETDD 120

  Fly    79 IDAFFKQSNATFKAM-------VLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETTYFYT 136
                :.:...:.:.|       :.|..:|.|.|:..|:...||.|..::...|:.:|:|..:|..
  Fly   121 ----YARKGVSMERMIKVYQDSISSLEHCPKPVITAVHKACIGAGVDLITAADIRYCTEDAFFQV 181

  Fly   137 PFTKLGLVPEGGSSYMLPLILG-RSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIWPKL 200
            ....:|:..:.|:...||..:| :|.|.|:........|.||:....|||:|  .:.:|::...|
  Fly   182 KEVDIGMAADVGTLQRLPKAVGSQSLARELCFTGRKFEAAEAHSSGLVSRLF--PDKDSLLTGAL 244

  Fly   201 RQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLL----QQFQHPEFAQAIIDFASRKNK-- 259
             ..:||..:......:..|:..:.:|...|:.....:|    ......:||||:....::.:|  
  Fly   245 -AVAELIASKSPVAVKTTKESLVYSLEHTNQEGLDHILLLNKLNLLSEDFAQAVAAQLTKDDKPV 308

  Fly   260 -AKL 262
             |||
  Fly   309 FAKL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 45/190 (24%)
CG9577NP_608375.1 crotonase-like 52..310 CDD:304874 57/260 (22%)
PRK05617 54..309 CDD:235533 57/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451161
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.