DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and CG14787

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_569914.2 Gene:CG14787 / 31096 FlyBaseID:FBgn0027793 Length:260 Species:Drosophila melanogaster


Alignment Length:246 Identity:58/246 - (23%)
Similarity:108/246 - (43%) Gaps:39/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGV------GDI- 63
            ::||:|||:..||..:|    ::....|..| |:.|.|...:.|..|.:||.:|.      |:: 
  Fly    10 FRELVVEQRSGLLHIRF----QRRWQRRTLY-ELMRALDLASADAAVKVVVLSGEFSAACGGEME 69

  Fly    64 --------------FTSGNDLSQSSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIG 114
                          ..|..:...|.:.::.....|.:|...:::....:..||:::|.|....:|
  Fly    70 PLALKQGLENRSRRTASHEEAVGSGDAEEQYIHEKAANFVMRSLAKKLLVHRKLLVAFVERQCVG 134

  Fly   115 IGATIVGLCDVAWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQ 179
            :|.::..|||:.:.:|.:.|...|:.|....:.|..:.:|.:      ..:|.|.:..|:..|.|
  Fly   135 LGLSVCSLCDLVFATELSAFVPAFSHLDPCTKVGPGWTVPHV------HWLLRLGDQASSSIALQ 193

  Fly   180 FNFVSRIFKASELESVIWPKLRQYSELPTNSLLQGKRLV----KDGFLENL 226
            ...|:.:.:..:   ..|.::.||..||:.|||..|||:    :|..|..|
  Fly   194 CGLVASVVREPQ---EFWHRVDQYLRLPSASLLATKRLLFRPWQDSLLAEL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 43/208 (21%)
CG14787NP_569914.2 crotonase-like 13..216 CDD:304874 46/216 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468437
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.