DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and HADHA

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_000173.2 Gene:HADHA / 3030 HGNCID:4801 Length:763 Species:Homo sapiens


Alignment Length:177 Identity:39/177 - (22%)
Similarity:79/177 - (44%) Gaps:5/177 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QGKLLVAKFNNPKKK-NCINRVAYQEMTRVLTEV-NDDEGVTIVVFTGVGDIFTSGNDLSQSSNT 76
            :|.:.|.:.|:|..| |.:::..:.|.:.|:.|: ..|:..:.|:.:.....|.:|.|::..:..
Human    46 KGDVAVVRINSPNSKVNTLSKELHSEFSEVMNEIWASDQIRSAVLISSKPGCFIAGADINMLAAC 110

  Fly    77 DDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCD--VAWCSETTYFYTPFT 139
            ..:....:.|... :.:|.......|.::|.:||..:|.|..:...|.  :|.....|...||..
Human   111 KTLQEVTQLSQEA-QRIVEKLEKSTKPIVAAINGSCLGGGLEVAISCQYRIATKDRKTVLGTPEV 174

  Fly   140 KLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRI 186
            .||.:|..|.:..||.::|...|.:::|....:.|..|.:...|.::
Human   175 LLGALPGAGGTQRLPKMVGVPAALDMMLTGRSIRADRAKKMGLVDQL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 39/177 (22%)
HADHANP_000173.2 fa_ox_alpha_mit 27..762 CDD:131494 39/177 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.