DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Hibch

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006244957.1 Gene:Hibch / 301384 RGDID:1308392 Length:385 Species:Rattus norvegicus


Alignment Length:164 Identity:43/164 - (26%)
Similarity:78/164 - (47%) Gaps:22/164 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGV-GDIFTSGNDL- 70
            |:|:|::|...|...|.||..|.::....:::...|.:...|....:::..|. |..|.:|.|: 
  Rat    36 EVLLERRGCAGVITLNRPKLLNALSLNMIRQIYPQLKKWERDPDTFLIIIKGAGGKAFCAGGDIK 100

  Fly    71 -----SQSSNTDDIDAFFKQ---SNATFKAMVLSFVNCRKIVLALVNGPAI--GIGATIVGLCDV 125
                 .::..|...|.|.::   :||        ..:|:|..:||::|..:  |:|.::.|...|
  Rat   101 ALSEAKKAGQTLSQDLFREEYILNNA--------IASCQKPYVALIDGITMGGGVGLSVHGQFRV 157

  Fly   126 AWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGR 159
            |  :|.:.|..|.|.:||.|:.|..|.||.:.|:
  Rat   158 A--TERSLFAMPETGIGLFPDVGGGYFLPRLQGK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 42/163 (26%)
HibchXP_006244957.1 PRK05617 33..377 CDD:235533 43/164 (26%)
ECH_2 46..374 CDD:292731 39/154 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.