DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Eci1

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_059002.2 Gene:Eci1 / 29740 RGDID:61892 Length:289 Species:Rattus norvegicus


Alignment Length:266 Identity:54/266 - (20%)
Similarity:104/266 - (39%) Gaps:64/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KELLVEQQGK--LLVAKFNNPKKKNCINRVAYQEMTRV---LTEVNDDEGVTIVVFTGV-GDIFT 65
            |.:|||::|:  :.|.||.||.    :|.::.:.:|..   |.::.:|:.:..|:.|.. ..||:
  Rat    32 KRVLVEKEGEAGIAVMKFKNPP----VNSLSLEFLTEFVISLEKLENDKSIRGVILTSERPGIFS 92

  Fly    66 SGNDLSQ--SSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNG--PA-------------- 112
            :|.||.:  ..|......::|.....:..:.||.:.    :::.:||  ||              
  Rat    93 AGLDLMEMYGRNPAHYAEYWKAVQELWLRLYLSNLT----LISAINGASPAGGCLMALTCDYRIM 153

  Fly   113 -------IGIGATIVGLCDVAWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSE 170
                   ||:..:::|:....|..: .|..|                    :|...|...|.|..
  Rat   154 ADNPKYTIGLNESLLGIVAPFWLKD-NYVNT--------------------IGHRAAERALQLGT 197

  Fly   171 PLSAQEAYQFNFVSRIFKASELESVIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECK 235
            .....||.:...|..:....::.|.....:.::..:|.:|....|.:::....:||||..||:  
  Rat   198 LFPPAEALKVGLVDEVVPEDQVHSKARSVMAKWFTIPDHSRQLTKSMMRKATADNLIKQREAD-- 260

  Fly   236 QLLQQF 241
              :|.|
  Rat   261 --IQNF 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 42/218 (19%)
Eci1NP_059002.2 ECH_1 39..285 CDD:278790 50/259 (19%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P42126 93..97 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.