DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Cdyl2

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017456726.1 Gene:Cdyl2 / 292044 RGDID:1309548 Length:551 Species:Rattus norvegicus


Alignment Length:263 Identity:74/263 - (28%)
Similarity:129/263 - (49%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QGYKELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGN 68
            :|:..:|:..|          ....|.:.....:|:.|.|.....|:. .:::.:.||.:|.||.
  Rat   303 EGFTHILLSSQ----------TSDNNALTPEIMKEVRRALCNAATDDS-KLLLLSAVGSVFCSGL 356

  Fly    69 DLSQ-----SSNTDDIDAFFKQSNATFKAM---VLSFVNCRKIVLALVNGPAIGIGATIVGLCDV 125
            |.|.     ||:..      |:|....:|:   |.:|:..:|.::..:||||:|:||:|:.|||:
  Rat   357 DYSYLIGRLSSDRR------KESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGLGASILPLCDI 415

  Fly   126 AWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKAS 190
            .|.||..:|.||:..:.|.|.|.|||..|.|||.:.|:|:|.....|:||||.....||::|..:
  Rat   416 VWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQEACSRGLVSQVFWPT 480

  Fly   191 ELESVIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIK-ANEAECKQLLQQFQHPEFAQAIIDFA 254
            .....:..::::.:......|...|.||: .||::::: .||.||..|.|.:...:...::..:.
  Rat   481 TFSQEVMLRVKEMASCSAVVLEDSKCLVR-SFLKSVLEDVNEKECLMLKQLWSSSKGLDSLFSYL 544

  Fly   255 SRK 257
            ..|
  Rat   545 QDK 547

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 60/195 (31%)
Cdyl2XP_017456726.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.