DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Eci3

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001009275.1 Gene:Eci3 / 291076 RGDID:1310224 Length:303 Species:Rattus norvegicus


Alignment Length:261 Identity:94/261 - (36%)
Similarity:147/261 - (56%) Gaps:10/261 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QGYKELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGN 68
            |..|::||..:..:....||.|.|||.|:...|:::...|...:.|..| |.|||||||.::|||
  Rat    47 QESKDILVTSEDGITTITFNRPSKKNAISFQMYKDIMLALKNASTDNSV-ITVFTGVGDYYSSGN 110

  Fly    69 DLSQSSNTDDIDAFFKQSNATFKAMVL-----SFVNCRKIVLALVNGPAIGIGATIVGLCDVAWC 128
            ||....|    ||...|...|..|::|     :|::..|.::|:|||||:||..|::||.|..:.
  Rat   111 DLRNFIN----DAGEIQDKVTMCAVLLREFVNTFIDFPKPLVAVVNGPAVGIAVTLLGLFDAVYA 171

  Fly   129 SETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELE 193
            |:...|:|||..||..||..|||..|.::|.:||:|:||..:.|:|:||:....|:.:|..|..|
  Rat   172 SDRATFHTPFIHLGQNPEACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFE 236

  Fly   194 SVIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFASRKN 258
            :.:|.:|:.|::|..|.:...|.|:::...:.|...|..||....::.:..|:..|:.:|.|||.
  Rat   237 TEVWTRLKTYAKLSPNGMRVFKELIRNHERQKLYTVNAEECAVGQERLKSEEWKDALRNFLSRKA 301

  Fly   259 K 259
            |
  Rat   302 K 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 74/192 (39%)
Eci3NP_001009275.1 crotonase-like 46..301 CDD:304874 92/258 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H74357
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.