DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Eci2

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001006967.1 Gene:Eci2 / 291075 RGDID:1359427 Length:391 Species:Rattus norvegicus


Alignment Length:257 Identity:95/257 - (36%)
Similarity:148/257 - (57%) Gaps:2/257 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QGYKELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGN 68
            |..|.:||..:|.:....||.|.|||.|....||::...|...:.|:.| |.||||.||.::|||
  Rat   135 QESKGILVTSEGGITKITFNRPSKKNAITFQMYQDIILALKNASTDDTV-ITVFTGAGDYYSSGN 198

  Fly    69 DLSQ-SSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETT 132
            ||:. :|.:..::....:.....:..|.:|::..|.::|:|||||:||..|::||.|..:.|:..
  Rat   199 DLTNFTSASGGMEEAANKGAIVLREFVNTFIDFPKPLVAVVNGPAVGISVTLLGLFDAVYASDRA 263

  Fly   133 YFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIW 197
            .|:|||:.||..||..|||..|.::|.:||:|:||..:.|:|:||:....|:.:|..|..|:.:|
  Rat   264 TFHTPFSHLGQSPEACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVW 328

  Fly   198 PKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFASRKNK 259
            .:|:.|::||.||:...|.|::....|.|...||.||..|..::...|...||:.|.:||.|
  Rat   329 TRLKTYAKLPPNSMRISKELIRKNEKEKLHAVNEEECTTLRARWLSEECINAIMSFVTRKPK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 70/188 (37%)
Eci2NP_001006967.1 ACBP 38..113 CDD:279259
Acyl-CoA binding. /evidence=ECO:0000250 64..68
crotonase-like 134..389 CDD:304874 93/254 (37%)
ECH-like 149..319 64/170 (38%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 196..200 3/3 (100%)
Microbody targeting signal. /evidence=ECO:0000255 389..391 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I3853
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 174 1.000 Inparanoid score I3979
OMA 1 1.010 - - QHG58780
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 1 1.000 - - FOG0003208
OrthoInspector 1 1.000 - - otm46426
orthoMCL 1 0.900 - - OOG6_103916
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3113
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.780

Return to query results.
Submit another query.