DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Eci2

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001103801.1 Gene:Eci2 / 23986 MGIID:1346064 Length:391 Species:Mus musculus


Alignment Length:254 Identity:93/254 - (36%)
Similarity:145/254 - (57%) Gaps:2/254 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGNDLS 71
            |::||..:..:....||.|.|||.|:...|:::...|...:.|..| :.||||.||.:.|||||:
Mouse   138 KDILVTSEDGITKITFNRPTKKNAISFQMYRDIILALKNASTDNTV-MAVFTGTGDYYCSGNDLT 201

  Fly    72 Q-SSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETTYFY 135
            . :|.|..|:..........:..|.||::..|.::|:|||||:||..|::||.|..:.|:...|:
Mouse   202 NFTSATGGIEEAASNGAVLLRDFVNSFIDFPKPLVAVVNGPAVGISVTLLGLFDAVFASDRATFH 266

  Fly   136 TPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIWPKL 200
            |||::||..||..|||..|.::|.:||:|:||..:.|:|:||:....|:.:|..|..|:.:|.:|
Mouse   267 TPFSQLGQSPEACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTRL 331

  Fly   201 RQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFASRKNK 259
            :.|::||.|::...|.|::....|.|...|..||..|..::...|...||:.|.|||.|
Mouse   332 KTYAKLPPNAMRISKELIRKNEKEKLYAVNAEECTTLQARWLSEECMNAIMSFVSRKPK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 70/188 (37%)
Eci2NP_001103801.1 ACBP 38..113 CDD:279259
Acyl-CoA binding. /evidence=ECO:0000250 64..68
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..136
crotonase-like 139..389 CDD:304874 90/250 (36%)
ECH-like 149..319 65/170 (38%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 196..200 3/3 (100%)
Microbody targeting signal. /evidence=ECO:0000255 389..391 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 163 1.000 Domainoid score I3943
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I4088
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58780
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 1 1.000 - - FOG0003208
OrthoInspector 1 1.000 - - otm44328
orthoMCL 1 0.900 - - OOG6_103916
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3644
SonicParanoid 1 1.000 - - X3113
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.