Sequence 1: | NP_612065.1 | Gene: | Dci / 38100 | FlyBaseID: | FBgn0035169 | Length: | 262 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_666220.1 | Gene: | Hibch / 227095 | MGIID: | 1923792 | Length: | 385 | Species: | Mus musculus |
Alignment Length: | 261 | Identity: | 59/261 - (22%) |
---|---|---|---|
Similarity: | 100/261 - (38%) | Gaps: | 77/261 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 ELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGV-GDIFTSGNDLS 71
Fly 72 QSSN--------TDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAI--GIGATIVGLCDVA 126
Fly 127 WCSETTYFYTPFTKLGLVPEGGSSYMLPLILG--------------------------------- 158
Fly 159 RSKASEILLLSEPLSAQ------EAY----------------QFNFVSRIFKASELESVIWPKLR 201
Fly 202 Q 202 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dci | NP_612065.1 | crotonase-like | 9..197 | CDD:119339 | 54/253 (21%) |
Hibch | NP_666220.1 | PRK05617 | 33..377 | CDD:235533 | 59/261 (23%) |
ECH_2 | 46..374 | CDD:292731 | 55/251 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1024 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |