DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Hibch

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_666220.1 Gene:Hibch / 227095 MGIID:1923792 Length:385 Species:Mus musculus


Alignment Length:261 Identity:59/261 - (22%)
Similarity:100/261 - (38%) Gaps:77/261 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGV-GDIFTSGNDLS 71
            |:|:|::|...|...|.||..|.::....:::...|.....|....:::..|. |..|.:|.|:.
Mouse    36 EVLLERRGCGGVITLNRPKFLNALSLNMIRQIYPQLKTWEQDPDTFLIIIKGAGGKAFCAGGDIK 100

  Fly    72 QSSN--------TDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAI--GIGATIVGLCDVA 126
            ..|.        |.|:   |::......|:    .:|:|..:||::|..:  |:|.::.|...||
Mouse   101 ALSEAKKARQNLTQDL---FREEYILNNAI----ASCQKPYVALIDGITMGGGVGLSVHGQFRVA 158

  Fly   127 WCSETTYFYTPFTKLGLVPEGGSSYMLPLILG--------------------------------- 158
              :|.:.|..|.|.:||.|:.|..|.||.:.|                                 
Mouse   159 --TERSLFAMPETGIGLFPDVGGGYFLPRLQGKLGYFLALTGYRLKGRDVHRAGIATHFVDSEKL 221

  Fly   159 RSKASEILLLSEPLSAQ------EAY----------------QFNFVSRIFKASELESVIWPKLR 201
            |....|:|.|..| ||:      |:|                ..:.::..|.|:.:|.:| ..||
Mouse   222 RVLEEELLALKSP-SAEDVAGVLESYHAKSKMDQDKSIIFEEHMDKINSCFSANTVEQII-ENLR 284

  Fly   202 Q 202
            |
Mouse   285 Q 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 54/253 (21%)
HibchNP_666220.1 PRK05617 33..377 CDD:235533 59/261 (23%)
ECH_2 46..374 CDD:292731 55/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.