DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and EHHADH

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001957.2 Gene:EHHADH / 1962 HGNCID:3247 Length:723 Species:Homo sapiens


Alignment Length:247 Identity:49/247 - (19%)
Similarity:93/247 - (37%) Gaps:32/247 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGNDLSQSSNTDDIDA 81
            |.:.:..|| ..|.|:....:::...|.:...|..:..:|..|....|::|.|:...|..     
Human    11 LALIRLRNP-PVNAISTTLLRDIKEGLQKAVIDHTIKAIVICGAEGKFSAGADIRGFSAP----- 69

  Fly    82 FFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETTYFYTPFTKLGLVPE 146
              :....|...:|.......|.|:|.:.|.|.|.|..:...|.............|...|||:|.
Human    70 --RTFGLTLGHVVDEIQRNEKPVVAAIQGMAFGGGLELALGCHYRIAHAEAQVGLPEVTLGLLPG 132

  Fly   147 GGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIWPKLRQYSELPTNSL 211
            ...:.:||.:.|...|.:::.....:.|.||.:...:.::..:..:|..|     ::::..::..
Human   133 ARGTQLLPRLTGVPAALDLITSGRRILADEALKLGILDKVVNSDPVEEAI-----RFAQRVSDQP 192

  Fly   212 LQGKRL----------VKDGFLENLIK---------ANEAECKQLLQQFQHP 244
            |:.:||          :...|.|.|:|         |.||..:.:....|:|
Human   193 LESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 36/179 (20%)
EHHADHNP_001957.2 Enoyl-CoA hydratase / isomerase 1..282 49/247 (20%)
fadJ 20..705 CDD:333311 46/237 (19%)
3-hydroxyacyl-CoA dehydrogenase 283..572
Microbody targeting signal 721..723
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.