DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and ech-3

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_505066.1 Gene:ech-3 / 179180 WormBaseID:WBGene00001152 Length:258 Species:Caenorhabditis elegans


Alignment Length:252 Identity:55/252 - (21%)
Similarity:100/252 - (39%) Gaps:34/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGNDLSQSSNTD 77
            |.|.:.:...|...||||:|.....::.....:.|:|..:...|..|.|..|.:|.||...|..:
 Worm    11 QDGPVFLIGINRANKKNCVNHATALQLIDAFEKFNEDSTMKTAVLYGEGGTFCAGYDLESVSKAE 75

  Fly    78 --DIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETTYFYTPFTK 140
              ::...|...   ::.|..|.:..:|.::|.:.|.|:..|..:..:.|:...|.:..|.....:
 Worm    76 HQEVSEDFCDK---YRYMGPSIMKIKKPLIAAIEGFAVAGGLELSLMADLRVSSPSAKFGVFCRR 137

  Fly   141 LGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIWPKLRQYSE 205
            :|:....|.:..||.::|..:|.:::|....:.||||.|:..|:||..                 
 Worm   138 VGVPLIDGGTVRLPRVIGLGRALDMILTGREVGAQEALQWGLVNRISD----------------- 185

  Fly   206 LPTNSLLQGKRLVKDGFLENLIKANEAEC-----KQLLQQFQHPEFAQAIIDFASRK 257
                   :||.:.:...|..||.::...|     :......:|.|......:|.|.|
 Worm   186 -------EGKAVEEAVKLGKLIASHPEICMLADRESTYYSLEHTEHESFEYEFGSTK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 44/185 (24%)
ech-3NP_505066.1 crotonase-like 7..247 CDD:304874 55/252 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.