DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and ech-8

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_501876.2 Gene:ech-8 / 177905 WormBaseID:WBGene00001157 Length:437 Species:Caenorhabditis elegans


Alignment Length:314 Identity:55/314 - (17%)
Similarity:108/314 - (34%) Gaps:122/314 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GYKELLVEQQGKLLVAKFNNPKKKNCIN--RVAYQ--------------------EMTRVLTEVN 47
            |::..|||         .||...:.|.|  .:.|:                    ::|....::|
 Worm    62 GFETYLVE---------VNNKAAEFCKNELEITYKREKAFRRLNDSKVEKLRKNLQITTDFQKLN 117

  Fly    48 DDEGVTIVVFTGV---GDIFTSGNDLSQSS-----NTDDIDA-----------------FFKQSN 87
            :.:.:...||..:   .::||..:.:.:.|     ||..:|.                 ||..:|
 Worm   118 NCDLIVEAVFEDMKLKKELFTKLDKICKPSCIFGTNTSSLDLNEMSSVLRDPTKVVGIHFFNPAN 182

  Fly    88 ------------ATFKAMVLSFVNCR---KIVLALVNGPAIGIGATIVGLCDVAWCSET-----T 132
                        .:.||:..:|..||   |:.:.:.|.||. :...::|:    :.:::     .
 Worm   183 LIRMVEVIYGSKTSSKAVATAFEACRSIKKLPVLVGNCPAF-VFNRLLGV----YLNQSQKLMYE 242

  Fly   133 YFYTP------FTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASE 191
            |.|.|      .|..|.:       |.||.:......:::   |.|..:..:         .||:
 Worm   243 YGYLPHQIDKIITNFGFL-------MGPLTVADMNGLDVM---EKLKKENGW---------PASD 288

  Fly   192 LESVIWPKLRQYSELPTNSLLQGKRLVKDGFLE----NLIKANEAECKQLLQQF 241
            .|..:| :.::|.           |....|:.:    ...|.|:.|.:||:::|
 Worm   289 FEKEVW-RQKRYG-----------RKTNKGYYKYDPNTHKKENDIEMEQLIRKF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 44/260 (17%)
ech-8NP_501876.2 FadB 38..312 CDD:224170 49/294 (17%)
3HCDH_N 41..220 CDD:280833 28/166 (17%)
3HCDH 223..310 CDD:279114 18/122 (15%)
3HCDH 347..>391 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.