DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and ech-4

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001366707.1 Gene:ech-4 / 174665 WormBaseID:WBGene00001153 Length:385 Species:Caenorhabditis elegans


Alignment Length:256 Identity:84/256 - (32%)
Similarity:137/256 - (53%) Gaps:5/256 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGNDLSQ- 72
            |.|.::||:.....|.|||.|.:....||.:.:.|...|:|:..:|.|.|..|..:.:||||:. 
 Worm   129 LSVTREGKVFKIALNRPKKFNALTLEMYQGIQKALEVSNNDKSTSITVITANGSYYCAGNDLTNF 193

  Fly    73 ----SSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETTY 133
                ....:.|......:....|..|.:::|..|.::||:||||:||..|::|:.|....::...
 Worm   194 KAAAGGTKEQIADMANTAKVIMKDYVNAYINHEKPLIALINGPAVGIAVTVLGMFDYVIATDKAS 258

  Fly   134 FYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIWP 198
            |:|||..||..|||.|||..|||:|..:|||:||:.:.:|||.|..:..|:.:...:|.:|....
 Worm   259 FHTPFAPLGQSPEGVSSYTFPLIMGSLRASEMLLVCKKISAQTAKDYGLVNEVVPDAEFQSHAQK 323

  Fly   199 KLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFASRKNK 259
            .:..:|:||..:|...|:|::....|.|::.|..|..|:.:::|..|..|||..|.::..|
 Worm   324 TVEAFSQLPPETLRINKKLLRSLHKEKLLEVNNIEADQICERWQSKECHQAIAAFMTKGAK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 66/192 (34%)
ech-4NP_001366707.1 ACBP 25..109 CDD:238248
crotonase-like 129..326 CDD:119339 66/196 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 149 1.000 Domainoid score I2715
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 151 1.000 Inparanoid score I2960
Isobase 1 0.950 - 0 Normalized mean entropy S2085
OMA 1 1.010 - - QHG58780
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 1 1.000 - - FOG0003208
OrthoInspector 1 1.000 - - otm14061
orthoMCL 1 0.900 - - OOG6_103916
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3644
SonicParanoid 1 1.000 - - X3113
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.760

Return to query results.
Submit another query.