DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and ech-1.2

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_491789.1 Gene:ech-1.2 / 172310 WormBaseID:WBGene00020347 Length:781 Species:Caenorhabditis elegans


Alignment Length:337 Identity:71/337 - (21%)
Similarity:127/337 - (37%) Gaps:114/337 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VEQQGKLLVAKFNNPK-KKNCINRVAYQEMTRVLTEVNDDEGV-TIVVFTGVGDIFTSGNDL--- 70
            ||:||.:.|.|.:.|. |:|.:|:..:.||...|.::..||.: :|||.:|..:.|.:|.|:   
 Worm    61 VEKQGDVAVVKIDLPNTKENVLNKALFAEMKATLDKLQSDESIKSIVVMSGKPNSFVAGADIQMI 125

  Fly    71 --------SQSSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCD--V 125
                    :::.:.:..:.||:...:            :|.|:|.:.|..:|.|..:...|.  :
 Worm   126 KAEGTATATETLSREGQEQFFRIEKS------------QKPVVAAIMGSCMGGGLELALACHYRI 178

  Fly   126 AWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFK-- 188
            |...:.|....|...|||:|..|.:..||.:.......::.|..:.:.|.:|.:...|.|:.:  
 Worm   179 AVNDKKTLLSLPEVMLGLLPGAGGTQRLPKLTTVQNVLDLTLTGKKIKADKAKKIGIVDRVIQPL 243

  Fly   189 ------ASE-----LESVIWPKLRQYSE------------------LPTNSLLQGKRLVKDGFLE 224
                  |:|     ||.:.....::.:.                  :.||||          ||:
 Worm   244 GDGLGPAAENTHKYLEEIAVKAAQELANGKLKINRDKGFMHKATQAVMTNSL----------FLD 298

  Fly   225 NLI----------------------------------KANEAECK---QLLQQFQHPEFAQAIID 252
            |::                                  |..|||.|   :|.|.||    ::|:|.
 Worm   299 NVVLKMAKDKLMKLTAGNYPAPLKILDVVRTAYVDPKKGFEAEAKAFGELSQTFQ----SKALIG 359

  Fly   253 F-----ASRKNK 259
            .     .::|||
 Worm   360 LFDGSTDAKKNK 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 50/213 (23%)
ech-1.2NP_491789.1 fa_ox_alpha_mit 46..780 CDD:131494 71/337 (21%)
crotonase-like 60..269 CDD:119339 50/219 (23%)
3HCDH_N 381..559 CDD:280833
3HCDH 561..656 CDD:279114
3HCDH 694..780 CDD:279114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.