Sequence 1: | NP_612065.1 | Gene: | Dci / 38100 | FlyBaseID: | FBgn0035169 | Length: | 262 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491789.1 | Gene: | ech-1.2 / 172310 | WormBaseID: | WBGene00020347 | Length: | 781 | Species: | Caenorhabditis elegans |
Alignment Length: | 337 | Identity: | 71/337 - (21%) |
---|---|---|---|
Similarity: | 127/337 - (37%) | Gaps: | 114/337 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 VEQQGKLLVAKFNNPK-KKNCINRVAYQEMTRVLTEVNDDEGV-TIVVFTGVGDIFTSGNDL--- 70
Fly 71 --------SQSSNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCD--V 125
Fly 126 AWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFK-- 188
Fly 189 ------ASE-----LESVIWPKLRQYSE------------------LPTNSLLQGKRLVKDGFLE 224
Fly 225 NLI----------------------------------KANEAECK---QLLQQFQHPEFAQAIID 252
Fly 253 F-----ASRKNK 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dci | NP_612065.1 | crotonase-like | 9..197 | CDD:119339 | 50/213 (23%) |
ech-1.2 | NP_491789.1 | fa_ox_alpha_mit | 46..780 | CDD:131494 | 71/337 (21%) |
crotonase-like | 60..269 | CDD:119339 | 50/219 (23%) | ||
3HCDH_N | 381..559 | CDD:280833 | |||
3HCDH | 561..656 | CDD:279114 | |||
3HCDH | 694..780 | CDD:279114 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |