DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and C32E8.9

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_491222.2 Gene:C32E8.9 / 171951 WormBaseID:WBGene00016325 Length:268 Species:Caenorhabditis elegans


Alignment Length:262 Identity:70/262 - (26%)
Similarity:119/262 - (45%) Gaps:57/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TYQGYKELLVEQQGKL---LVAKFNNPKKKNCINRVAYQEMTRVL---TEVNDDEGVTIVVFTGV 60
            ::|| ..:.|::..||   |....:.|:|.||::    .||.:..   ||:..|:...|:|.:||
 Worm    18 SWQG-GAIRVQRNEKLKTRLDVILDRPEKNNCLS----GEMMKQFGEHTELFSDDQNAIIVVSGV 77

  Fly    61 GDIFTSGNDLSQSSNTDD----IDAFFKQSNATFKAMVLSFVNCR-KIVLALVNGPAIGIGATIV 120
            |..|.||.||....:..|    :..|      .:.:.:||.::.. .|.:|.::|.|:| |||.:
 Worm    78 GKSFCSGADLGLIKDISDQKLGVQMF------EYMSSILSLLHSSPAISIAKIHGHALG-GATEI 135

  Fly   121 GLCDVAWCSET-----------TYFYTPFTKLGLVPE-GGSSYMLPLILGRSKASEILLLSEPLS 173
                   ||.|           .:|.   :|:|:||. ||:.|| ..|:||.:|...:..:..:|
 Worm   136 -------CSSTDIRIAHSGSKIAFFQ---SKMGIVPSWGGAEYM-EGIMGRGRALAAMGRANVMS 189

  Fly   174 AQEAYQFNFVSRIFKA-SELESVIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQL 237
            |:||....:|..::|: .|.|:.|    .|.:..........|.::      |.:|..:.|.||:
 Worm   190 AEEAKDQGYVDYVYKSEDEAENFI----NQVASAGLKVTRAQKAML------NAVKIGKTEQKQV 244

  Fly   238 LQ 239
            |:
 Worm   245 LE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 59/211 (28%)
C32E8.9NP_491222.2 crotonase-like 24..207 CDD:119339 57/204 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.