DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Hadha

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_570839.2 Gene:Hadha / 170670 RGDID:620512 Length:763 Species:Rattus norvegicus


Alignment Length:180 Identity:43/180 - (23%)
Similarity:77/180 - (42%) Gaps:11/180 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QGKLLVAKFNNPKKK-NCINRVAYQEMTRVLTEV--NDDEGVTIVVFTGVGDIFTSGNDLSQ--S 73
            :|.:.|.:.|:|..| |.:|:....|...|:.|:  ||.....:::.:..| .|.:|.|::.  |
  Rat    46 KGDVAVIRINSPNSKVNTLNKEVQSEFVEVMNEIWANDQIRSAVLISSKPG-CFVAGADINMLAS 109

  Fly    74 SNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCD--VAWCSETTYFYT 136
            ..|....|...|..   :.|........|.|:|.::|..:|.|..:...|.  :|.....|....
  Rat   110 CTTPQEAARISQEG---QKMFEKLEKSPKPVVAAISGSCLGGGLELAIACQYRIATKDRKTVLGV 171

  Fly   137 PFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRI 186
            |...||::|..|.:..||.::|...|.:::|....:.|..|.:...|.::
  Rat   172 PEVLLGILPGAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAKKMGLVDQL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 43/180 (24%)
HadhaNP_570839.2 fa_ox_alpha_mit 29..762 CDD:131494 43/180 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.