DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and CDYL2

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_011521168.1 Gene:CDYL2 / 124359 HGNCID:23030 Length:540 Species:Homo sapiens


Alignment Length:263 Identity:74/263 - (28%)
Similarity:130/263 - (49%) Gaps:27/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QGYKELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGN 68
            :|:..:|:..|          ....|.:.....:|:.|.|.....|:. .:::.:.||.:|.||.
Human   292 EGFTHILLSSQ----------TSDNNALTPEIMKEVRRALCNAATDDS-KLLLLSAVGSVFCSGL 345

  Fly    69 DLSQ-----SSNTDDIDAFFKQSNATFKAM---VLSFVNCRKIVLALVNGPAIGIGATIVGLCDV 125
            |.|.     ||:..      |:|....:|:   |.:|:..:|.::..:||||:|:||:|:.|||:
Human   346 DYSYLIGRLSSDRR------KESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGLGASILPLCDI 404

  Fly   126 AWCSETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKAS 190
            .|.||..:|.||:..:.|.|.|.|||..|.|||.:.|:|:|.....|:||||.....||::|..:
Human   405 VWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQEACSRGLVSQVFWPT 469

  Fly   191 ELESVIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIK-ANEAECKQLLQQFQHPEFAQAIIDFA 254
            .....:..::::.:......|.:.|.||: .||::::: .||.||..|.|.:...:...::..:.
Human   470 TFSQEVMLRVKEMASCSAVVLEESKCLVR-SFLKSVLEDVNEKECLMLKQLWSSSKGLDSLFSYL 533

  Fly   255 SRK 257
            ..|
Human   534 QDK 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 60/195 (31%)
CDYL2XP_011521168.1 CHROMO 40..89 CDD:214605
crotonase-like 286..482 CDD:119339 61/206 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42274
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3644
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.