DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and Auh

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_057918.2 Gene:Auh / 11992 MGIID:1338011 Length:314 Species:Mus musculus


Alignment Length:253 Identity:56/253 - (22%)
Similarity:111/253 - (43%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGV-TIVVFTGVGDIFTSGNDLSQS 73
            |.|:...::|...|....||.:::...:.:::.:..:..|:.| ||::.:.|..||.:|.||.:.
Mouse    57 LEEENRGIVVLGINRAYGKNALSKNLLKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKER 121

  Fly    74 S--NTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETTYFYT 136
            :  ::.::..|..:    .::::....|.....:|.::|.|:|.|..:...||:...:.:.....
Mouse   122 AKMHSSEVGPFVSK----IRSVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGL 182

  Fly   137 PFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIWPKLR 201
            ..|||.::|.||.:..||..:|.|.|.|::..:..|..|||.....:|.:.:.::.....:   |
Mouse   183 VETKLAIIPGGGGTQRLPRAIGMSLAKELIFSARVLDGQEAKAVGLISHVLEQNQEGDAAY---R 244

  Fly   202 QYSELPTNSLLQG-------KRLVKDGFLENLIK--ANEAECKQLLQQFQHPEFAQAI 250
            :..:|....|.||       |..:..|...:|:.  |.|..|           :||.|
Mouse   245 KALDLAREFLPQGPVAMRVAKLAINQGMEVDLVTGLAIEEAC-----------YAQTI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 42/189 (22%)
AuhNP_057918.2 crotonase-like 61..314 CDD:304874 54/249 (22%)
RNA-binding. /evidence=ECO:0000250|UniProtKB:Q13825 80..94 0/13 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.