DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and ECI2

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_996667.2 Gene:ECI2 / 10455 HGNCID:14601 Length:394 Species:Homo sapiens


Alignment Length:260 Identity:96/260 - (36%)
Similarity:147/260 - (56%) Gaps:9/260 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GYKELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGND 69
            |::.|:|..:..:....||.|||||.||...|.|:.|.|...:.|:.: |.|.||.||.::||||
Human   138 GFETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSI-ITVLTGNGDYYSSGND 201

  Fly    70 LSQSSNTDDIDAFFKQSNATFKAMVL-SFVNC----RKIVLALVNGPAIGIGATIVGLCDVAWCS 129
            |   :|..||.....:..|...|::| .||.|    .|.::|:|||||:||..|::||.|..:.|
Human   202 L---TNFTDIPPGGVEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYAS 263

  Fly   130 ETTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELES 194
            :...|:|||:.||..|||.|||..|.|:..:||:|:|:..:.|:|.||.....|:.:|..|..:.
Human   264 DRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKATEMLIFGKKLTAGEACAQGLVTEVFPDSTFQK 328

  Fly   195 VIWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFASRKNK 259
            .:|.:|:.:::||.|:|...|.:::....|.|...|..||..|..::...|...|:::|.|||:|
Human   329 EVWTRLKAFAKLPPNALRISKEVIRKREREKLHAVNAEECNVLQGRWLSDECTNAVVNFLSRKSK 393

  Fly   260  259
            Human   394  393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 75/192 (39%)
ECI2NP_996667.2 ACBP 40..113 CDD:279259
Acyl-CoA binding. /evidence=ECO:0000250 66..70
crotonase-like 142..335 CDD:119339 76/196 (39%)
ECH-like 151..322 71/174 (41%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 198..202 3/3 (100%)
Microbody targeting signal. /evidence=ECO:0000255 392..394 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 155 1.000 Domainoid score I4209
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4158
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG58780
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 1 1.000 - - FOG0003208
OrthoInspector 1 1.000 - - otm42274
orthoMCL 1 0.900 - - OOG6_103916
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3113
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.