DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and cdyl

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031759810.1 Gene:cdyl / 100491952 XenbaseID:XB-GENE-6462830 Length:547 Species:Xenopus tropicalis


Alignment Length:265 Identity:82/265 - (30%)
Similarity:134/265 - (50%) Gaps:24/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKELLV-EQQGKLLVAKFNNPKKKNCINRVAYQEMTRVL-TEVNDDEGVTIVVFTGVGDIFTSGN 68
            |::::| :|.|...:.......:.|.:|....:|:...| |...||.  .:|:|:.||.:|..|.
 Frog   290 YRDIVVRKQDGFTHILLSTKSSENNSLNPEVMKEVQGALNTAAADDS--KLVLFSAVGSVFCCGL 352

  Fly    69 DLSQSSN--TDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSET 131
            |......  |||......:.....:..|.:|:..:|.::..|||||:|:||:|:.||||.|.:|.
 Frog   353 DFIYFIRRLTDDRKRESTKMAEAIRTFVNTFIQFKKPIIVAVNGPAVGLGASILPLCDVIWANEK 417

  Fly   132 TYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVI 196
            .:|.||:|..|..|:|.||.|.|.|:|.:.|:|:||....|:||||.....||::|         
 Frog   418 AWFQTPYTTFGQSPDGCSSLMFPKIMGLASANEMLLSGRKLTAQEACAKGLVSQVF--------- 473

  Fly   197 WP------KLRQYSELPTNS---LLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIID 252
            ||      .:.:..||.|.:   |.:.|.||::....:|.:.||.||:.|.:.:..|:...:::.
 Frog   474 WPGTFTQEVMVRIKELVTCNPVVLEESKGLVRNVMRGDLEQTNERECEVLKKIWGSPQGMDSMLK 538

  Fly   253 FASRK 257
            :..||
 Frog   539 YLQRK 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 63/191 (33%)
cdylXP_031759810.1 CD_CDY 15..63 CDD:349284
crotonase-like 293..489 CDD:119339 65/206 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.