DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and eci3

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_031760013.1 Gene:eci3 / 100490656 XenbaseID:XB-GENE-22167220 Length:302 Species:Xenopus tropicalis


Alignment Length:255 Identity:96/255 - (37%)
Similarity:140/255 - (54%) Gaps:6/255 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QGYKELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSGN 68
            |.::.|.:..|..:.....|.|::||..:...:.|:...|.:...|..| ..|.||.||.|||||
 Frog    50 QKFETLHITHQDNITTITMNRPQRKNAFSLQMFNELELALDDAAADNSV-FTVLTGAGDYFTSGN 113

  Fly    69 DLSQS-SNTDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSETT 132
            ||:.: .|..:|    |:.....:..|..|::..|.::|:||||||||||||:||.|:.:.|:..
 Frog   114 DLNNALQNPSEI----KEEKFDLRRFVRKFIDFPKPLVAVVNGPAIGIGATILGLMDLVYASDKA 174

  Fly   133 YFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESVIW 197
            .|.|||.||||.||..|||..|.|:|.:||:|:||.::.|:||||.....|:.:|..|..:..:.
 Frog   175 SFNTPFIKLGLCPEACSSYTFPKIMGFTKATEVLLFNKILTAQEACDLGLVTEVFPGSTFQQDVR 239

  Fly   198 PKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFASRK 257
            .:|:.|:.||.|||...|:|::....|.|....:|||..|.:.....|...|||.|..:|
 Frog   240 ARLKDYASLPKNSLAFSKQLIRGLEKEKLYAVCDAECDLLAKMVTSEEAMNAIIQFFQKK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 74/188 (39%)
eci3XP_031760013.1 crotonase-like 61..300 CDD:419961 93/244 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H74357
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.