DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dci and eci2

DIOPT Version :9

Sequence 1:NP_612065.1 Gene:Dci / 38100 FlyBaseID:FBgn0035169 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_012819853.2 Gene:eci2 / 100216270 XenbaseID:XB-GENE-961246 Length:413 Species:Xenopus tropicalis


Alignment Length:259 Identity:93/259 - (35%)
Similarity:146/259 - (56%) Gaps:3/259 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YQGYKELLVEQQGKLLVAKFNNPKKKNCINRVAYQEMTRVLTEVNDDEGVTIVVFTGVGDIFTSG 67
            ::.|:.:.|.::..::....|.|:|||.|....|:|:...|.|...||.| ..|.:|.||.|.||
 Frog   155 HKKYETIQVSREDNIIKIFLNRPEKKNAITLTMYKEIGEALEEAGKDESV-FAVLSGFGDYFCSG 218

  Fly    68 NDLSQSSN--TDDIDAFFKQSNATFKAMVLSFVNCRKIVLALVNGPAIGIGATIVGLCDVAWCSE 130
            |||:..:|  .:..:...|.|....:..|..|::..|.::|:|||||.||..||:||.|:.:.::
 Frog   219 NDLNNFTNIPPEGKEKMAKDSADLLETFVSKFIDFPKPLIAVVNGPATGISVTILGLFDLVYATD 283

  Fly   131 TTYFYTPFTKLGLVPEGGSSYMLPLILGRSKASEILLLSEPLSAQEAYQFNFVSRIFKASELESV 195
            ...|:|||::||..|||.|||..|.|:|..||:|:||.::.|:||||.....|:.:|.....:..
 Frog   284 RATFHTPFSQLGQSPEGCSSYTFPRIMGLGKATEMLLFNKKLTAQEACNLGLVAEVFPDGSFQKE 348

  Fly   196 IWPKLRQYSELPTNSLLQGKRLVKDGFLENLIKANEAECKQLLQQFQHPEFAQAIIDFASRKNK 259
            :|.:::.||.||.|||...|:|::....|.|...|..||::|.:::...|...|||.|..::.|
 Frog   349 VWERIKDYSTLPKNSLAFSKQLIRVNEKEKLHAVNIQECERLKERWLSEECMNAIISFFQKRAK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DciNP_612065.1 crotonase-like 9..197 CDD:119339 70/189 (37%)
eci2XP_012819853.2 ACBP 60..131 CDD:412233
crotonase-like 161..411 CDD:419961 91/250 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3827
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I3989
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1471901at2759
OrthoFinder 1 1.000 - - FOG0003208
OrthoInspector 1 1.000 - - otm49505
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3644
SonicParanoid 1 1.000 - - X3113
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.