DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ARF5 and CG17819

DIOPT Version :9

Sequence 1:NP_001653.1 Gene:ARF5 / 381 HGNCID:658 Length:180 Species:Homo sapiens
Sequence 2:NP_650994.1 Gene:CG17819 / 42579 FlyBaseID:FBgn0038915 Length:186 Species:Drosophila melanogaster


Alignment Length:176 Identity:55/176 - (31%)
Similarity:94/176 - (53%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    14 GKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN----ICFTV-------WD 67
            |.::..:|::|||.|||:|:..  :|.||        ||.|:.|..|    ..||:       ||
  Fly    17 GSQKSCLLILGLDNAGKSTLTD--RLAEI--------FNGESKESNNQVSEWSFTINNFRVQLWD 71

Human    68 VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVQESADELQKMLQEDELRDAVLLVFANKQDMPN 132
            :.|:.|.|.:|..|::....||||:||.|..|:.|:...|..:|...||.:|.||:.:||:|...
  Fly    72 INGELKNRQIWPKYYKKVNVLIFVLDSTDALRLSEARCVLCDVLMHQELDNAPLLIVSNKKDASG 136

Human   133 AMPVSELTDKLGLQHLRSRTWYVQATCATQGTGLYDGLDWLSHELS 178
            ::.:|.:.|.:||..|..|.|..:......|:|:.:.::|::.:::
  Fly   137 SLSMSTVIDLMGLYRLTGRDWTFEECSMRTGSGVQEIVNWINEKIN 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ARF5NP_001653.1 YlqF_related_GTPase 1..180 CDD:424112 55/176 (31%)
CG17819NP_650994.1 Arf_Arl 22..180 CDD:206644 54/167 (32%)
Ras 23..183 CDD:278499 54/170 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0070
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53833
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.