DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD5 and AT3G45880

DIOPT Version :9

Sequence 1:NP_612063.2 Gene:JMJD5 / 38097 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_190174.2 Gene:AT3G45880 / 823731 AraportID:AT3G45880 Length:345 Species:Arabidopsis thaliana


Alignment Length:297 Identity:68/297 - (22%)
Similarity:112/297 - (37%) Gaps:74/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 IPQLDA-PSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASD 226
            |.:.|: ||..:|........:|.::...|.|||||..|.|..||.....:..|.:.:..|..:|
plant    21 IDRFDSQPSPVKFLRNYVSQSKPCVISKAITHWPALKLWSDPAYLTGALSDDVVSLHLTPNGCAD 85

  Fly   227 EWSQQLVKIRD--FLSRQFGK----------EPSKAGQNIEYLAQHELFAQIPALKEDISIPDYC 279
                .:....|  |.|....|          :.|..|..:.||.|          :.|....:|.
plant    86 ----AVTGDSDLCFASAHVEKVLFPEALKVVQSSCKGLKVGYLQQ----------QNDCFRTEYS 136

  Fly   280 TISNEDTPGAVD------------IKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTD 332
            |:: .|..|.::            :..|:|...:|:..|.|...||...|.|.|..:|..|.|..
plant   137 TVA-LDCDGDIEWATEAFGCSPEAVNLWIGTDDSVTSFHKDHYENLYAVVSGEKHFLLLPPTDVH 200

  Fly   333 NLY--PHDSEFLANTARIDAAQLDPE------------TYPLVAK-----VKF---------YQL 369
            .||  .:.:...:.....||.:|:.|            .||...|     :||         :..
plant   201 RLYIEQYPAANYSYHRDTDAFKLEVEEPVRHVPWSSVDPYPSPEKEASERLKFPLFFDGPKPFHC 265

  Fly   370 LLQPGDCLYMPPKWWHYVRSEAP-----SFSVSFWWE 401
            .::.|:.||:|..|:|:| |:.|     :.:|::|::
plant   266 TVKAGEVLYLPSMWFHHV-SQTPGDGGYTIAVNYWYD 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 64/285 (22%)
AT3G45880NP_190174.2 Cupin_8 30..306 CDD:404504 64/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.