DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD5 and HSPBAP1

DIOPT Version :9

Sequence 1:NP_612063.2 Gene:JMJD5 / 38097 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_078886.2 Gene:HSPBAP1 / 79663 HGNCID:16389 Length:488 Species:Homo sapiens


Alignment Length:252 Identity:72/252 - (28%)
Similarity:100/252 - (39%) Gaps:52/252 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 QPTLLLNTIQHWPALHKWLDLNYLLQVAGNR------------TVP-IEIGSNYASDEWSQQLV- 233
            ||.:..|.:..|||.| | :..||.||...:            ||| .|...||......:.|. 
Human    42 QPAIFCNMVFDWPARH-W-NAKYLSQVLHGKQIRFRMGMKSMSTVPQFETTCNYVEATLEEFLTW 104

  Fly   234 ---------KIRDFLSRQFGKEPSKAGQNIEYLAQHELFAQIPALKEDISIPDYCTISNEDTPG- 288
                     ..||:       :.||.....:|.....||.....|.:|:...|:      ..|| 
Human   105 NCDQSSISGPFRDY-------DHSKFWAYADYKYFVSLFEDKTDLFQDVKWSDF------GFPGR 156

  Fly   289 -AVDIKAWLGPAGTVSPMHYDPKH-NLLCQVFGSKRIILAAPADTDNLYP------HDSEFLANT 345
             ..:...|:|..|..:|.|.|... ||:.||.|.||..|..|.||..|||      ..|.|    
Human   157 NGQESTLWIGSLGAHTPCHLDSYGCNLVFQVQGRKRWHLFPPEDTPFLYPTRIPYEESSVF---- 217

  Fly   346 ARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAP-SFSVSFWWE 401
            ::|:....|.:.:|...|.:.:.:.|.||..|::|..|||||.|..| :.|::.|.|
Human   218 SKINVVNPDLKRFPQFRKAQRHAVTLSPGQVLFVPRHWWHYVESIDPVTVSINSWIE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 71/250 (28%)
HSPBAP1NP_078886.2 Cupin_8 37..272 CDD:316171 70/248 (28%)
Interaction with HSPB1. /evidence=ECO:0000250 88..208 36/132 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 369..415
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.