DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD5 and Hspbap1

DIOPT Version :9

Sequence 1:NP_612063.2 Gene:JMJD5 / 38097 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_006522532.1 Gene:Hspbap1 / 66667 MGIID:1913917 Length:507 Species:Mus musculus


Alignment Length:269 Identity:65/269 - (24%)
Similarity:104/269 - (38%) Gaps:62/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 QPTLLLNTIQHWPALHKWL-----------DLNYLLQVAGNRTVPIEIGSNYASDEWSQQLVKIR 236
            ||.:..|.:..||:.| |.           .:.:.:.:.|..|||     .|.: |.|.....:.
Mouse    42 QPAIFCNMVFDWPSRH-WTAKHLSKVLEGKQIRFRMGLRGTGTVP-----QYET-ECSYVDATLE 99

  Fly   237 DFLSRQFGKE----PSKAGQNIEY--LAQHELFAQIPALKEDISIPDYCTISNEDTPG--AVDIK 293
            :||:....:.    |.|..::.::  .|.::.|..:...|.|: .......|:...||  ..:..
Mouse   100 EFLTWNCDQSSISGPFKDYEHSKFWAYADYKYFVTLFEDKTDV-FQQEVVWSDFGFPGRNGQEST 163

  Fly   294 AWLGPAGTVSPMHYDPKH-NLL----------------------CQ-VFGSKRIILAAPADTDNL 334
            .|:|..|..:|.|.|... ||:                      || .:..||..|..|.||..|
Mouse   164 LWIGSFGAHTPCHLDSYGCNLVFQRTEKFVETQRLHCGPLDVDRCQEAWIRKRWHLFPPEDTPFL 228

  Fly   335 YP------HDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAP- 392
            ||      ..|.|    ::|:....|.:.:|...|.:.:.:.|.||..|::|..|||||.|..| 
Mouse   229 YPTRIPYEESSVF----SKINVVNPDLKCFPQFQKARRHMVTLSPGQVLFVPRHWWHYVESLDPV 289

  Fly   393 SFSVSFWWE 401
            :.|::.|.|
Mouse   290 TVSINSWIE 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 64/267 (24%)
Hspbap1XP_006522532.1 Cupin_8 37..296 CDD:372651 63/265 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.