DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD5 and HIF1AN

DIOPT Version :9

Sequence 1:NP_612063.2 Gene:JMJD5 / 38097 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_011538242.1 Gene:HIF1AN / 55662 HGNCID:17113 Length:369 Species:Homo sapiens


Alignment Length:359 Identity:89/359 - (24%)
Similarity:138/359 - (38%) Gaps:100/359 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 STSPAQKDACSEILDEAQLLGCMEDWSELKVALMDYLDKDGAVALNSAPLPTLEPLTRVTSNCDI 163
            :.:.|......|..:||..||...|.|:|:                |...|| .|:.|::     
Human     4 TAAEAVASGSGEPREEAGALGPAWDESQLR----------------SYSFPT-RPIPRLS----- 46

  Fly   164 PQLDAPSLEEFQTKCFEAG------------------QPTLLLNTIQHWPALHKWLDLNYLLQVA 210
             |.| |..||....  |.|                  :|.:|.:|...:||| || ||.||.:..
Human    47 -QSD-PRAEELIEN--EVGGGAASKGRGGRYPVERSEEPVVLTDTNLVYPAL-KW-DLEYLQENI 105

  Fly   211 GNRTVPIEIGSNYA---SDEWSQQLVKIRDFLSRQFGKEPSKAGQNIEYLAQHELFAQIPALKED 272
            ||....:...|.:.   .||  :::...::|          |...|.|.:..||...::    :|
Human   106 GNGDFSVYSASTHKFLYYDE--KKMANFQNF----------KPRSNREEMKFHEFVEKL----QD 154

  Fly   273 ISIPD-----YCTISNEDTPG---AVDI--------------KAW---------LGPAGTVSPMH 306
            |....     |...:..||.|   .:|.              :.|         :|..|.|:|.|
Human   155 IQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAH 219

  Fly   307 YDPKHNLLCQVFGSKRIILAAPADTDNLYPHDSEFLAN-TARIDAAQLDPETYPLVAKVKFYQLL 370
            ||.:.|...|:.|.||.||..|...:.|||:......: .:::|....|.|.:|....|..|:.:
Human   220 YDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETV 284

  Fly   371 LQPGDCLYMPPKWWHYVRS---EAPSFSVSFWWE 401
            :.|||.||:|..|||::.|   ...:.:|:||::
Human   285 VGPGDVLYIPMYWWHHIESLLNGGITITVNFWYK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 72/284 (25%)
HIF1ANXP_011538242.1 Cupin_8 80..317 CDD:290351 67/254 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.