DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD5 and hspbap1

DIOPT Version :9

Sequence 1:NP_612063.2 Gene:JMJD5 / 38097 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:XP_005167885.1 Gene:hspbap1 / 445320 ZFINID:ZDB-GENE-040808-38 Length:456 Species:Danio rerio


Alignment Length:254 Identity:72/254 - (28%)
Similarity:107/254 - (42%) Gaps:56/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 QPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYASD-------EWSQQLVKIRDFLS 240
            :|.:.||....||||| |...:  |.....:.:...:|.. :.|       |.|.....|::|||
Zfish    27 KPAVFLNMTTDWPALH-WTVEH--LSACLTKRIRFRVGKR-SEDMAPLFETECSYVEATIKEFLS 87

  Fly   241 ------------------RQFGKEPSKAGQNIEYLAQHELFAQIPALKEDISIPDYCTISNEDTP 287
                              ::|.     |..:.:|:||  ||...||:.:|:...|:      ..|
Zfish    88 WTANDGEPLVGPFLDYHCKEFW-----AYADYKYIAQ--LFQDKPAMFQDVVWSDF------GFP 139

  Fly   288 G--AVDIKAWLGPAGTVSPMHYDPKH-NLLCQVFGSKRIILAAPADTDNLYP------HDSEFLA 343
            |  ..|...|:|.....:|.|.|... ||:.|:.|.||..|..|.||..|||      ..|.|  
Zfish   140 GRDGRDSTLWIGTQCANTPCHLDSYGCNLVFQIQGRKRWHLFPPDDTACLYPTRVPYEESSVF-- 202

  Fly   344 NTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSEAP-SFSVSFWWE 401
              :.::..:.|.:.:|...:.:.|.:.||||..|::|..|||||.|..| :.||:.|.|
Zfish   203 --SHVNVIRPDLKKFPAYGRARLYTVTLQPGQVLFVPRHWWHYVESVDPVTVSVNSWIE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 71/252 (28%)
hspbap1XP_005167885.1 Cupin_8 16..264 CDD:290351 72/254 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.