DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD5 and hif1an

DIOPT Version :9

Sequence 1:NP_612063.2 Gene:JMJD5 / 38097 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_988915.1 Gene:hif1an / 394511 XenbaseID:XB-GENE-966944 Length:352 Species:Xenopus tropicalis


Alignment Length:274 Identity:70/274 - (25%)
Similarity:117/274 - (42%) Gaps:52/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 IPQLD--APSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYA- 224
            ||:|.  .|..||.    .:..:|.:|.:|.....|| || ||:||.:..||....:...:::. 
 Frog    45 IPRLQHGDPRAEEL----IDKEEPVVLTDTNLVHTAL-KW-DLDYLEENIGNGDFSVYSANSHKF 103

  Fly   225 --SDEWSQQLVKIRDFLSRQFGKEPSKAGQNIEYLAQHELFAQIPALKEDISIPDYCTISNEDTP 287
              .||  :::|..::|       :|..:.:.:::.........|...:.|..:  |...:..||.
 Frog   104 LYYDE--KKMVNFKNF-------KPKSSREEMKFPEFVNKLKDIQERESDERL--YLQQTLNDTV 157

  Fly   288 G---AVDI--------------KAW---------LGPAGTVSPMHYDPKHNLLCQVFGSKRIILA 326
            |   .||.              ..|         :|..|.|:|.|||.:.|...|:.|.||.||.
 Frog   158 GRKIVVDFLGFNWNWINKQQAKHGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILF 222

  Fly   327 APADTDNLYPHDSEFLAN-TARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRS- 389
            .|...:.|||:......: .:::|....|.|.:|....|..|:.::.|||.||:|..|||::.| 
 Frog   223 PPEQFECLYPYPVHHPCDRQSQVDFENPDFERFPNFRNVLGYETVVGPGDVLYIPMYWWHHIESL 287

  Fly   390 --EAPSFSVSFWWE 401
              ...:.:|:||::
 Frog   288 MDGGITITVNFWYK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 66/261 (25%)
hif1anNP_988915.1 Cupin_8 56..300 CDD:372651 65/260 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.