DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD5 and Hif1an

DIOPT Version :9

Sequence 1:NP_612063.2 Gene:JMJD5 / 38097 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001107221.1 Gene:Hif1an / 309434 RGDID:1308281 Length:349 Species:Rattus norvegicus


Alignment Length:333 Identity:87/333 - (26%)
Similarity:137/333 - (41%) Gaps:84/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ACSEILDEAQLLGCMEDWSELKVALMDYLDKDGAVALNSAPLPTLEPLTRVTSNCDIPQLDAPSL 171
            |..|..:||:..|...|.|:|:                |...|| .|:.|::      |.| |..
  Rat    12 ASGEAREEAEAPGPAWDESQLR----------------SYSFPT-RPIPRLS------QSD-PRA 52

  Fly   172 EEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIGSNYA---SDEWSQQLV 233
            ||.    .|..:|.:|.:|...:||| || ||.||.:..||....:...|.:.   .||  :::.
  Rat    53 EEL----IENEEPVVLTDTNLVYPAL-KW-DLEYLQENIGNGDFSVYSASTHKFLYYDE--KKMA 109

  Fly   234 KIRDFLSRQFGKEPSKAGQNIEYLAQHELFAQIPAL-----KEDISIPDYCTISNEDTPG---AV 290
            ..::|          |...|.|.:..||...::.|:     :|.:    |...:..||.|   .:
  Rat   110 NFQNF----------KPRSNREEIKFHEFVEKLQAIQQRGGEERL----YLQQTLNDTVGRKIVM 160

  Fly   291 DI--------------KAW---------LGPAGTVSPMHYDPKHNLLCQVFGSKRIILAAPADTD 332
            |.              :.|         :|..|.|:|.|||.:.|...|:.|.||.||..|...:
  Rat   161 DFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGHKRCILFPPDQFE 225

  Fly   333 NLYPHDSEFLAN-TARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRS---EAPS 393
            .|||:......: .:::|....|.|.:|....|..|:.::.|||.||:|..|||::.|   ...:
  Rat   226 CLYPYPVHHPCDRQSQVDFDNPDYERFPNFRNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGIT 290

  Fly   394 FSVSFWWE 401
            .:|:||::
  Rat   291 ITVNFWYK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 71/266 (27%)
Hif1anNP_001107221.1 Cupin_8 53..297 CDD:290351 70/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.