DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD5 and Tyw5

DIOPT Version :9

Sequence 1:NP_612063.2 Gene:JMJD5 / 38097 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001163944.1 Gene:Tyw5 / 301419 RGDID:1311269 Length:315 Species:Rattus norvegicus


Alignment Length:259 Identity:74/259 - (28%)
Similarity:113/259 - (43%) Gaps:57/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 IPQLDAPSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIE--------- 218
            :|:|...|.|:|....:...:| |:|..:.......|| .::||.||.|.:.|.|.         
  Rat     8 VPRLRGVSREQFMEHLYPQRKP-LVLEGLDLGSCTSKW-TVDYLSQVGGTKEVKIHVAAVAQMDF 70

  Fly   219 IGSNY-------------ASDEWSQQLVKIRD--FLSRQFGKEPSKAGQNIEYLAQHELFAQIPA 268
            |..|:             |::|..::....:|  :..|..|::|.|   :|..:.|     |.|:
  Rat    71 ISKNFVYRTLPFNKLVQRAAEETHKEFFISQDERYYLRSLGEDPRK---DIADIRQ-----QFPS 127

  Fly   269 LKEDISIP-------DYCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILA 326
            |.|||:.|       .:.::....:||   ::.|         .|||...|.|.||.|.|||.|.
  Rat   128 LGEDITFPMFFREEQFFSSVFRISSPG---LQLW---------THYDVMDNFLIQVTGKKRITLF 180

  Fly   327 APADTDNLYPHDSEFLANTARIDAAQLDPETYPLVAKVKFYQLLLQPGDCLYMPPKWWHYVRSE 390
            :|.|...||...|:  :....||:..||  .|||..|.:.|:..|:.||.|::|..|:|.|.||
  Rat   181 SPRDAQYLYLSGSK--SEVLNIDSPDLD--KYPLFPKARRYECSLEAGDVLFIPALWFHNVVSE 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 71/250 (28%)
Tyw5NP_001163944.1 Cupin_8 17..264 CDD:290351 71/250 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1385616at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.