DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment JMJD5 and CG43319

DIOPT Version :9

Sequence 1:NP_612063.2 Gene:JMJD5 / 38097 FlyBaseID:FBgn0035166 Length:401 Species:Drosophila melanogaster
Sequence 2:NP_001247340.1 Gene:CG43319 / 12798278 FlyBaseID:FBgn0263024 Length:57 Species:Drosophila melanogaster


Alignment Length:36 Identity:10/36 - (27%)
Similarity:16/36 - (44%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 SQQLVKIRDFLSRQFGKEP--SKAGQNIEYLAQHEL 262
            |.|..|.:.:...:.||..  .|.| |.|.:..:|:
  Fly    19 SGQKGKWKGYKDEEMGKSSYWKKVG-NAESIVGNEI 53

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
JMJD5NP_612063.2 Cupin_8 172..401 CDD:290351 10/36 (28%)
CG43319NP_001247340.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2132
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.