DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13887 and YET2

DIOPT Version :9

Sequence 1:NP_001286891.1 Gene:CG13887 / 38096 FlyBaseID:FBgn0035165 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_013754.1 Gene:YET2 / 855056 SGDID:S000004643 Length:160 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:44/192 - (22%)
Similarity:84/192 - (43%) Gaps:38/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVWTLIAGFLYAEIALVLLLVLPVLTPYRWNRFFKSKF-LSMLGQQAHIYFLLIMGILVIFLL 64
            |.:...::...|..|:|::.:||||:  |.|..|:...:: :....::...|.:.||..:.:..:
Yeast     1 MGVYLAVLFSLLVIEMAILFILVLPL--PQRMRRWLYIRYSIISTNKKFRTYMVGIMIFVGLLFI 63

  Fly    65 EAIR--EMRKYSGLQQSNEVHLNVEMQHSMKLFRA--QRNFYISGFAIFLALVIRRLVNLICTQA 125
            ::.:  ::|..:...|.|...:|..........||  |||.|||||.|:..:.|..:::::    
Yeast    64 DSWKRSQIRVSTYRNQKNPYIINSVTPVDALASRAYNQRNVYISGFIIYFYICILTVMSIL---- 124

  Fly   126 NLMAQSEASFKQAQSATAAARSLLENKNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREK 187
                                |.::|..:..|   ||:|   |...||| |.|:...:|.::|
Yeast   125 --------------------RRIVEWNDKMK---AGDD---ILKEKLR-RKQKYLEELQKKK 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13887NP_001286891.1 Bap31 1..205 CDD:283239 44/192 (23%)
YET2NP_013754.1 Bap31 1..160 CDD:413240 44/192 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346610
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1962
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12701
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.